PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_26376A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 312aa    MW: 33773.2 Da    PI: 5.906
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_26376AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.72.7e-132172148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT....TTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg....kgRtlkqcksrwqkyl 48
                               +g W++eEde+l++ + ++G g+W+++++  g    +  ++k+c++rw +yl
  Oropetium_20150105_26376A 21 KGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGkhyaLSSCGKSCRLRWINYL 72
                               678***********************************************97 PP

2Myb_DNA-binding47.93.1e-1578122147
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                rg+++++E++ +v +++ lG++ W+ Ia++++ gRt++++k++w++ 
  Oropetium_20150105_26376A  78 RGSFSQQEEDAIVGLHEILGNR-WSQIASHLP-GRTDNEIKNFWNSC 122
                                899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3481672IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-191875IPR009057Homeodomain-like
SuperFamilySSF466894.49E-2619119IPR009057Homeodomain-like
SMARTSM007178.0E-102074IPR001005SANT/Myb domain
PfamPF002497.1E-122172IPR001005SANT/Myb domain
CDDcd001672.99E-102472No hitNo description
PROSITE profilePS5129424.51773127IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2576127IPR009057Homeodomain-like
SMARTSM007172.2E-1477125IPR001005SANT/Myb domain
PfamPF002491.4E-1378122IPR001005SANT/Myb domain
CDDcd001672.00E-1080120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGRNPGHAAA ATGGVQLKLR KGLWSPEEDE KLYNHIIRYG VGCWSSVPKL AGKHYALSSC  60
GKSCRLRWIN YLRPDLKRGS FSQQEEDAIV GLHEILGNRW SQIASHLPGR TDNEIKNFWN  120
SCLKKKLRQC GIDPSTHKPA VSSAAASPQD QVKQEQQQVF DPFPLTDDSF GGGGFDDDAP  180
AVAALYGGCK HDAAPGNFVD YSSVLDVSEN LGYGESSSNS SNNNWNCCAP PEANTTNAID  240
NGEATMHWGA SESSKQQVQP PFAGYGGGGD DGEHKFLLPC HHGGQQEQSM PHFDFDIGRG  300
AVVGEFNLEF F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27191275108B-MYB
1h8a_C1e-261912725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9657051e-130EU965705.1 Zea mays clone 288150 myb-related protein Hv33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006644576.11e-136PREDICTED: myb-related protein Hv33-like
SwissprotP200274e-88MYB3_HORVU; Myb-related protein Hv33
TrEMBLJ3L3A01e-136J3L3A0_ORYBR; Uncharacterized protein
STRINGOB01G37060.11e-136(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-68myb domain protein 86